HPA023261
antibody from Atlas Antibodies
Targeting: NIBAN2
bA356B19.6, C9orf88, DKFZP434H0820, FAM129B, FLJ13518, FLJ22151, FLJ22298, MINERVA
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023261 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023261, RRID:AB_1848375
- Product name
- Anti-FAM129B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LSNLVMEELGPELKAELGPRLKGKPQERQRQWIQI
SDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIR
TDMDQIITSKEHLASKIRAFILPKAEVCVRNHV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references FAM129B is a novel regulator of Wnt/β-catenin signal transduction in melanoma cells
Conrad W, Major M, Cleary M, Ferrer M, Roberts B, Marine S, Chung N, Arthur W, Chien A, Berndt J, Moon R
F1000Research
F1000Research
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-FAM129B antibody HPA023261 (A) shows similar pattern to independent antibody HPA021417 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN