PAB21379

NIBAN2 antibody from Abnova Corporation
bA356B19.6, C9orf88, DKFZP434H0820, FAM129B, FLJ13518, FLJ22151, FLJ22298, MINERVA

Antibody data

Product number
PAB21379
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21379, RRID:AB_10962889
Product name
FAM129B polyclonal antibody
Provider product page
Abnova Corporation - PAB21379
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM129B.
Antigen sequence
EVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKM
QSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHM
REQMDNAVYTFETLLHQELGKGPTKEELCKSIQRV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -