HPA009668

SERPINB6 antibody from Sigma-Aldrich
CAP, DFNB91, PI6, PTI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009668
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009668, RRID:AB_1079919
Product name
Anti-SERPINB6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009668
Antibody type
Polyclonal
Antigen
Serpin B6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGA
KGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVN
KTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQ
AEMEELDFISAVEKSRKHINTWVAEKTEGKIAELL
SPGSV
Storage
-20C
Provider Type Product Number
- No reagents -