H00139135-M10

PASD1 antibody from Abnova Corporation
CT63
No application information provided.

Antibody data

Product number
H00139135-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00139135-M10, RRID:AB_1237809
Product name
PASD1 monoclonal antibody (M10), clone 1C8
Provider product page
Abnova Corporation - H00139135-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PASD1.
Antigen sequence
MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQ
VTLQLLDGFMITLSTDGVIICVAENISSLLGHLPA
EIVGKKLLSLLPDEEKDEVYQKIILKFPLL
Isotype
IgG
Antibody clone number
1C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -