HPA011122

PASD1 antibody from Sigma-Aldrich
CT63
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011122
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011122, RRID:AB_1854990
Product name
Anti-PASD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011122
Antibody type
Polyclonal
Antigen
PAS domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASA
QPLQPSSPVAYDIISQELELMKKLKEQLEERTWLL
HDAIQNQQNALELMMDHLQKQPNTLRHVVIPDLQS
SEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLS
NSL
Storage
-20C
Provider Type Product Number
- No reagents -