HPA011152

PASD1 antibody from Sigma-Aldrich
CT63
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011152
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011152, RRID:AB_1854991
Product name
Anti-PASD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011152
Antibody type
Polyclonal
Antigen
PAS domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEKDEVYQKIILKFPLLNSETHIEFCCHLKRGNVE
HGDSSAYENVKFIVNVRDICNEFPVVFSGLFSSHL
CADFAACVPQEDRLYLVGNVCILRTQLLQQLYTSK
AVSDEAVLTQDSDEEPFVGELSSSQGQRGHTSMKA
VYVEPAAA
Storage
-20C
Provider Type Product Number
- No reagents -