Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008192-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008192-M01, RRID:AB_530008
- Product name
- CLPP monoclonal antibody (M01), clone 3E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CLPP.
- Antigen sequence
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKH
TKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVH
PPQDGEDEPTLVQKEPVEAAPAAEPVPAST- Isotype
- IgG
- Antibody clone number
- 3E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Diphenylarsinic acid promotes degradation of glutaminase C by mitochondrial Lon protease.
Kita K, Suzuki T, Ochi T
The Journal of biological chemistry 2012 May 25;287(22):18163-72
The Journal of biological chemistry 2012 May 25;287(22):18163-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CLPP monoclonal antibody (M01), clone 3E2. Western Blot analysis of CLPP expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CLPP is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CLPP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol