HPA010649

CLPP antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010649
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010649, RRID:AB_1078538
Product name
Anti-CLPP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010649
Antibody type
Polyclonal
Antigen
Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQA
TDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESA
MERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTL
VQKEPVEAAPAAEPVPA
Storage
-20C
Provider Type Product Number
- No reagents -