Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000826-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000826-M01, RRID:AB_606019
- Product name
- CAPNS1 monoclonal antibody (M01), clone 3C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAPNS1.
- Antigen sequence
KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLN
EHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFR
AFKSLDKDGTGQIQVNIQE- Isotype
- IgG
- Antibody clone number
- 3C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Overexpression of a minimal domain of calpastatin suppresses IL-6 production and Th17 development via reduced NF-κB and increased STAT5 signals.
The calpain inhibitor calpeptin prevents bleomycin-induced pulmonary fibrosis in mice.
Vitamin E and C supplementation does not ameliorate muscle dysfunction after anterior cruciate ligament surgery.
Iguchi-Hashimoto M, Usui T, Yoshifuji H, Shimizu M, Kobayashi S, Ito Y, Murakami K, Shiomi A, Yukawa N, Kawabata D, Nojima T, Ohmura K, Fujii T, Mimori T
PloS one 2011;6(10):e27020
PloS one 2011;6(10):e27020
The calpain inhibitor calpeptin prevents bleomycin-induced pulmonary fibrosis in mice.
Tabata C, Tabata R, Nakano T
Clinical and experimental immunology 2010 Dec;162(3):560-7
Clinical and experimental immunology 2010 Dec;162(3):560-7
Vitamin E and C supplementation does not ameliorate muscle dysfunction after anterior cruciate ligament surgery.
Barker T, Leonard SW, Hansen J, Trawick RH, Ingram R, Burdett G, Lebold KM, Walker JA, Traber MG
Free radical biology & medicine 2009 Dec 1;47(11):1611-8
Free radical biology & medicine 2009 Dec 1;47(11):1611-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CAPNS1 expression in transfected 293T cell line by CAPNS1 monoclonal antibody (M01), clone 3C4.Lane 1: CAPNS1 transfected lysate(28.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAPNS1 monoclonal antibody (M01), clone 3C4. Western Blot analysis of CAPNS1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CAPNS1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CAPNS1 on HeLa cell. [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CAPNS1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol