HPA017195

KLK10 antibody from Sigma-Aldrich
NES1, PRSSL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017195
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017195, RRID:AB_1852596
Product name
Anti-KLK10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017195
Antibody type
Polyclonal
Antigen
Kallikrein-10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYNKGLTCSSITILSPKECEVFYPGVVTNNMICAG
LDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGS
AQHPAVYTQICKYMSWINKVIRSN
Storage
-20C
Provider Type Product Number
- No reagents -