HPA021942

MAGEA4 antibody from Atlas Antibodies
CT1.4, MAGE-41, MAGE-X2, MAGE4, MAGE4A, MAGE4B, MGC21336
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021942
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021942, RRID:AB_1853490
Product name
Anti-MAGEA4
Provider product page
Atlas Antibodies - HPA021942
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVD
ELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPV
IFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGL
SYDGLLGNNQIFPKTGLLIIVLGT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -