HPA021942

MAGEA4 antibody from Sigma-Aldrich
CT1.4, MAGE-41, MAGE-X2, MAGE4, MAGE4A, MAGE4B, MGC21336
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021942
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021942, RRID:AB_1853490
Product name
Anti-MAGEA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021942
Antibody type
Polyclonal
Antigen
Melanoma-associated antigen 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVD
ELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPV
IFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGL
SYDGLLGNNQIFPKTGLLIIVLGT
Storage
-20C
Provider Type Product Number
- No reagents -