HPA015522

SRPK2 antibody from Sigma-Aldrich
SFRSK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015522
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015522, RRID:AB_1857479
Product name
Anti-SRPK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015522
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase SRPK2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSS
YEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPV
ACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGD
LPKAKTRAADLLVNPL
Storage
-20C
Provider Type Product Number
- No reagents -