HPA015673

CHMP3 antibody from Sigma-Aldrich
CGI-149, NEDF, VPS24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015673
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015673, RRID:AB_1858761
Product name
Anti-VPS24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015673
Antibody type
Polyclonal
Antigen
RING finger protein 103 (Zinc finger protein 103 homolog) (Zfp-103) (KF-1) (hKF-1)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDT
FESMDDQEEMEEEAEMEIDRILFEITAGALGKAPS
KVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRL
ATLR
Storage
-20C
Provider Type Product Number
- No reagents -