HPA024116

PUS7 antibody from Atlas Antibodies
FLJ20485
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024116
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024116, RRID:AB_1848754
Product name
Anti-PUS7
Provider product page
Atlas Antibodies - HPA024116
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PGFDVIYPKHKIQEAYREMLTADNLDIDNMRHKIR
DYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNT
DVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYAT
MAIREVLKMDTSIKNQTQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -