HPA006779

USP28 antibody from Sigma-Aldrich
KIAA1515
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006779
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006779, RRID:AB_1080517
Product name
Anti-USP28 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006779
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 28 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWEEVERDSYGGLRNVSAYCLMYINDKLPYFNAEA
APTESDQMSEVEALSVELKHYIQEDNWRFEQEVEE
WEEEQSCKIPQMESSTNSSSQDYSTSQEPSVASSH
GVRCLSSEHAVIVKEQTAQAIANTARA
Storage
-20C
Provider Type Product Number
- No reagents -