HPA019543

SFXN1 antibody from Atlas Antibodies
FLJ12876, SLC56A1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019543
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019543, RRID:AB_1856789
Product name
Anti-SFXN1
Provider product page
Atlas Antibodies - HPA019543
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRN
ILLTNEQLESARKIVHDYRQGIVPPGLTENELWRA
KYIYDSAFHPDTGEKMILIGRMSAQV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -