HPA012082

AC022966.1 antibody from Atlas Antibodies
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA012082
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012082, RRID:AB_1858682
Product name
Anti-USP36
Provider product page
Atlas Antibodies - HPA012082
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGL
ISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTG
KRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNG
CIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKK
PAPP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -