HPA012082

USP36 antibody from Atlas Antibodies
FLJ12851, KIAA1453
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA012082
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012082, RRID:AB_1236099
Product name
Anti-USP36
Provider product page
Atlas Antibodies - HPA012082
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGL
ISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTG
KRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNG
CIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKK
PAPP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -