HPA012082

USP36 antibody from Sigma-Aldrich
FLJ12851, KIAA1453
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012082
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012082, RRID:AB_1858682
Product name
Anti-USP36 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012082
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 36 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGL
ISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTG
KRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNG
CIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKK
PAPP
Storage
-20C
Provider Type Product Number
- No reagents -