HPA016830

TMEM19 antibody from Sigma-Aldrich
FLJ10936
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016830
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016830, RRID:AB_1858107
Product name
Anti-TMEM19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016830
Antibody type
Polyclonal
Antigen
Transmembrane protein 19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YTGLDESTGMVVNSPTNKARHIAGKPILDN
Storage
-20C
Provider Type Product Number
- No reagents -