H00079786-B01

KLHL36 antibody from Abnova Corporation
C16orf44, FLJ12543

Antibody data

Product number
H00079786-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079786-B01, RRID:AB_1137837
Product name
C16orf44 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079786-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C16orf44 protein.
Antigen sequence
MMEGSRQTRVSRPYKISESSKVYRWADHSSTVLQR
LNEQRLRGLFCDVVLVADEQRVPAHRNLLAVCSDY
FNSMFTIGMREAFQKEVELIGASYIGLKAVVDFLY
GGELVLDGGNIDYVLETAHLLQIWTVVDFCCEYLE
QEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHF
GTLSFTPDFLQNVSMQKLCVYLSSSEVQRECEHDL
LQAALQWLTQQPEREAHARQVLENIHFPLIPKNDL
LHRVKPAVCSLLPKEANCEGFIEEAVRYHNNLAAQ
PVMQTKRTALRTNQERLLFVGGEVSERCLELSDDT
CYLDAKSEQWVKETPLPARRSHHCVAVLGGFIFIA
GGSFSRDNGGDAASNLLYRYDPRCKQWIKVASMNQ
RRVDFYLASIEDMLVAIGGRNENGALSSVETYSPK
TDSWSYVAGLPRFTYGHAGTIYKDFVYISGGHDYQ
IGPYRKNLLCYDHRTDVWEERRPMTTARGWHSMCS
LGDSIYSIGGSDDNIESMERFDVLGVEAYSPQCNQ
WTRVAPLLHANSESGVAVWEGRIYILGGYSWENTA
FSKTVQVYDREADKWSRGVDLPKAIAGGSACVCAL
EPRPEDKKKKGKGKRHQDRGQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -