ABIN404952

KLHL36 antibody from antibodies-online
C16orf44, FLJ12543

Antibody data

Product number
ABIN404952
Provider
antibodies-online
Product name
anti-Kelch-Like 36 (Drosophila) (KLHL36) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404952
Antibody type
Polyclonal
Antigen
The immunogen for anti-C16orf44 antibody: synthetic peptide directed towards the middle region of human C16orf44
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
EDMLVAIGGRNENGALSSVETYSPKTDSWSYVAGL
PRFTY GHAGTIYKDF
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -