AV34616

KLHL36 antibody from Sigma-Aldrich
C16orf44, FLJ12543
No application information provided.

Antibody data

Product number
AV34616
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV34616, RRID:AB_1845578
Product name
Anti-C16ORF44 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV34616
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human C16orf44 with an internal ID of P05806
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
ELVLDGGNIDYVLETAHLLQIWTVVDFCCEYLEQE
VSEDNYLYLQELASI
Storage
-20C
Provider Type Product Number
- No reagents -