SAB2100252

KLHL36 antibody from Sigma-Aldrich
C16orf44, FLJ12543
No application information provided.

Antibody data

Product number
SAB2100252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100252, RRID:AB_10604486
Product name
Anti-C16ORF44 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100252
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_079007.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDMLVAIGGRNENGALSSVETYSPKTDSWSYVAGL
PRFTYGHAGTIYKDF
Storage
-20C
Provider Type Product Number
- No reagents -