Antibody data

Product number
PAB21236
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21236, RRID:AB_10962366
Product name
HEATR4 polyclonal antibody
Provider product page
Abnova Corporation - PAB21236
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human HEATR4.
Description
Rabbit polyclonal antibody raised against recombinant HEATR4.
Reactivity
Human
Host
Rabbit
Antigen sequence
EKKKPELLLPVYYRLPSYFQQAETVEIMPGNKSTE
DIHEKTSLSQPQTQSYFRQVTPRAGKFAYSTDNTF
EQEIYFDEVQIIHQIGAKRDQIVLENLNRYNKQLS
KVFPETPEKWSAQAIPEASY
Isotype
IgG
Vial size
100 μL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -