HPA003642

HEATR4 antibody from Sigma-Aldrich
MGC48595
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003642, RRID:AB_1079376
Product name
Anti-HEATR4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003642
Antibody type
Polyclonal
Antigen
HEAT repeat-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGDLHDDVRIKAITTCATAALERPRIATSQRDSDK
TIQDLPEVLLPALEAALCDKNAHVRMAAAICQYAI
QSHNPLARNIMQTALLKGNSVDSWAAAQCLALEGT
ATYPVIKRILHQLFTKKNEDTEEQSYILLSYLSEK
TTLIH
Storage
-20C
Provider Type Product Number
- No reagents -