HPA011765

SENP1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011765, RRID:AB_1079907
Product name
Anti-SENP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011765
Antibody type
Polyclonal
Antigen
Sentrin-specific protease 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLY
LETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKP
VPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEE
EREIYRQLLQMVTGK
Storage
-20C
Provider Type Product Number
- No reagents -