HPA021223

PTRH1 antibody from Sigma-Aldrich
C9orf115, PTH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021223
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021223, RRID:AB_1845798
Product name
Anti-PTRH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021223
Antibody type
Polyclonal
Antigen
Probable peptidyl-tRNA hydrolase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISC
LNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQ
ELLPLLLDRATD
Storage
-20C
Provider Type Product Number
- No reagents -