HPA021448

ATXN7L1 antibody from Atlas Antibodies
ATXN7L4, KIAA1218, MGC33190
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021448
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021448, RRID:AB_1845213
Product name
Anti-ATXN7L1
Provider product page
Atlas Antibodies - HPA021448
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLPLSFDKSEGKKRKNSSSSSKACKITKMPGMNSV
HKKNPPSLLAPVPDPVNSTSSRQVGKNSSLALSQS
SPSSISSPGHSRQKNTNRTGRIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -