H00222255-B01

ATXN7L1 antibody from Abnova Corporation
ATXN7L4, KIAA1218, MGC33190

Antibody data

Product number
H00222255-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00222255-B01, RRID:AB_1571570
Product name
ATXN7L4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00222255-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ATXN7L4 protein.
Antigen sequence
MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRK
VPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKE
GGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSAC
NQVVKPQVFQSHCGRKQDNRRNEGISRSGPESSQA
IEKHQV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -