HPA006988

ZMPSTE24 antibody from Atlas Antibodies
FACE-1, HGPS, PRO1, STE24, Ste24p
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006988
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006988, RRID:AB_1080659
Product name
Anti-ZMPSTE24
Provider product page
Atlas Antibodies - HPA006988
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -