HPA006988

ZMPSTE24 antibody from Sigma-Aldrich
FACE-1, HGPS, PRO1, STE24, Ste24p
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006988
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006988, RRID:AB_1080659
Product name
Anti-ZMPSTE24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006988
Antibody type
Polyclonal
Antigen
CAAX prenyl protease 1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
Storage
-20C
Provider Type Product Number
- No reagents -