Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1106730 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Cyclin N-terminal Domain Containing 1 (CNTD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N terminal of human CNTD1
- Description
- Immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLE
KSVSYQAVEILERFM- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human ACHN; WB Suggested Anti-CNTD1 Antibody Titration: 0.2-1 ug/ml. Positive Control: ACHN cell lysate; CNTD1 antibody - N-terminal region (AP46134PU-N) in Human ACHN cells using Western Blot