HPA023324

CNTD1 antibody from Sigma-Aldrich
CNTD, FLJ40137
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023324
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023324, RRID:AB_1848931
Product name
Anti-CNTD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023324
Antibody type
Polyclonal
Antigen
Cyclin N-terminal domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELDVLKSLNFRINLPTPLAYVETLLEVLGYNGCLV
PAMRLHATCLTLLDLVYLLHEPIYESLLRASIENS
TPSQLQGEKFT
Storage
-20C
Provider Type Product Number
- No reagents -