Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006632 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006632, RRID:AB_1079686
- Product name
- Anti-PSME1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAV
TKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIR
NAYAVLYDIILKNFEKLKKPRGETKGMIY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Proteomic analysis identifies galectin-1 as a predictive biomarker for relapsed/refractory disease in classical Hodgkin lymphoma
Kamper P, Ludvigsen M, Bendix K, Hamilton-Dutoit S, Rabinovich G, Moller M, Nyengaard J, Honore B, d'Amore F
Blood 2011 June;117(24):6638-6649
Blood 2011 June;117(24):6638-6649
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal and non-germinal center cells.
- Sample type
- HUMAN