HPA006632

PSME1 antibody from Sigma-Aldrich
IFI5111, PA28alpha
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006632
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006632, RRID:AB_1079686
Product name
Anti-PSME1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006632
Antibody type
Polyclonal
Antigen
Proteasome activator complex subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAV
TKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIR
NAYAVLYDIILKNFEKLKKPRGETKGMIY
Storage
-20C
Provider Type Product Number
- No reagents -