Antibody data

Product number
H00001553-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001553-D01, RRID:AB_10962792
Product name
CYP2A13 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00001553-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human CYP2A13 protein.
Antigen sequence
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPP
GPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFT
IHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQA
TFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGV
GKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLS
RTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQ
FTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLE
DFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEK
NPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFL
LLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMP
YTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFL
PKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTT
IMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMS
FLPR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -