AV41803

CYP2A13 antibody from Sigma-Aldrich
CPAD, CYP2A
No application information provided.

Antibody data

Product number
AV41803
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV41803, RRID:AB_1847431
Product name
Anti-CYP2A13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV41803
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CYP2A13 with an internal ID of P10932
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
GSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFV
PFSIGKRYCFGEGLA
Storage
-20C
Provider Type Product Number
- No reagents -