SAB1401105

CYP2A13 antibody from Sigma-Aldrich
CPAD, CYP2A
No application information provided.

Antibody data

Product number
SAB1401105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401105, RRID:AB_10609429
Product name
Anti-CYP2A13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401105
Antibody type
Polyclonal
Antigen
CYP2A13 (AAI53001.1, 1 a.a. ~ 494 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPP
GPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFT
IHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQA
TFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGV
GKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLS
RTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQ
FTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLE
DFIAKKVEHN
Storage
-20C
Provider Type Product Number
- No reagents -