Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310310 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nicotinamide phosphoribosyltransferase (NAMPT) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRT
PAGNF VTLEEGKGDL- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Elevated plasma level of visfatin/pre-B cell colony-enhancing factor in patients with type 2 diabetes mellitus.
Chen MP, Chung FM, Chang DM, Tsai JC, Huang HF, Shin SJ, Lee YJ
The Journal of clinical endocrinology and metabolism 2006 Jan;91(1):295-9
The Journal of clinical endocrinology and metabolism 2006 Jan;91(1):295-9
No comments: Submit comment
No validations: Submit validation data