HPA016949

GANC antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016949
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016949, RRID:AB_1849465
Product name
Anti-GANC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016949
Antibody type
Polyclonal
Antigen
Neutral alpha-glucosidase C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASQPVMRPLWVEFPDELKTFDMEDEYMLGSALLVH
PVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCT
VKIPVALDTIPVFQRGGSVIPIKTTVGKSTGWMTE
SSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQ
Storage
-20C
Provider Type Product Number
- No reagents -