Antibody data

Product number
ABIN630299
Provider
antibodies-online
Product name
anti-Microfibrillar-Associated Protein 3-Like (MFAP3L) (N-Term) antibody
Provider product page
antibodies-online - ABIN630299
Antibody type
Polyclonal
Antigen
MFAP3 L antibody was raised using the N terminal of MFAP3 corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
Description
Purified
Reactivity
Human, Mouse, Rat, Canine
Host
Rabbit
Epitope
N-Term
Vial size
100 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Provider Type Product Number
- No reagents -