HPA017986

MFAP3L antibody from Sigma-Aldrich
KIAA0626, NYD-sp9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017986
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017986, RRID:AB_1853842
Product name
Anti-MFAP3L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017986
Antibody type
Polyclonal
Antigen
Microfibrillar-associated protein 3-like Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALI
NCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGK
WQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNN
TVTLRVIFTSGD
Storage
-20C
Provider Type Product Number
- No reagents -