HPA008862

LONP2 antibody from Atlas Antibodies
LONP, LONPL, MGC4840
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008862
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008862, RRID:AB_888712
Product name
Anti-LONP2
Provider product page
Atlas Antibodies - HPA008862
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVV
GSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEV
EQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVE
MLDMSVPAVAKLRR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -