HPA008862

LONP2 antibody from Sigma-Aldrich
LONP, LONPL, MGC4840
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008862, RRID:AB_2137156
Product name
Anti-LONP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008862
Antibody type
Polyclonal
Antigen
peroxisomal LON protease-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVV
GSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEV
EQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVE
MLDMSVPAVAKLRR
Storage
-20C
Provider Type Product Number
- No reagents -