HPA019664

KCNC2 antibody from Atlas Antibodies
Kv3.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019664
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019664, RRID:AB_1855578
Product name
Anti-KCNC2
Provider product page
Atlas Antibodies - HPA019664
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNM
ACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEP
PLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTC
ASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSP
YNSPCPLRRSRSPIPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -