HPA019664

KCNC2 antibody from Sigma-Aldrich
Kv3.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019664
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019664, RRID:AB_1855578
Product name
Anti-KCNC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019664
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily C member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNM
ACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEP
PLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTC
ASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSP
YNSPCPLRRSRSPIPS
Storage
-20C
Provider Type Product Number
- No reagents -