Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000314-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000314-A01, RRID:AB_463561
- Product name
- AOC2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant AOC2.
- Antigen sequence
RAEFTQMWRHLKEVELPKAPIFLSSTFNYNGSTLA
AVHATPRGLRSGDRATWMALYHNISGVGLFLHPVG
LELLLDHRALDPAHWTVQQVFYLGHYYADL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The unique substrate specificity of human AOC2, a semicarbazide-sensitive amine oxidase.
Kaitaniemi S, Elovaara H, Grön K, Kidron H, Liukkonen J, Salminen T, Salmi M, Jalkanen S, Elima K
Cellular and molecular life sciences : CMLS 2009 Aug;66(16):2743-57
Cellular and molecular life sciences : CMLS 2009 Aug;66(16):2743-57
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AOC2 polyclonal antibody (A01), Lot # 051206JC01 Western Blot analysis of AOC2 expression in IMR-32 ( Cat # L008V1 ).