Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405189 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-HBP1 (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the middle region of human HBP1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNP
DCWKR KRTNSGSQQH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The acetylation of transcription factor HBP1 by p300/CBP enhances p16INK4A expression.
miR-17-5p promotes human breast cancer cell migration and invasion through suppression of HBP1.
Alterations of the HBP1 transcriptional repressor are associated with invasive breast cancer.
Wang W, Pan K, Chen Y, Huang C, Zhang X
Nucleic acids research 2012 Feb;40(3):981-95
Nucleic acids research 2012 Feb;40(3):981-95
miR-17-5p promotes human breast cancer cell migration and invasion through suppression of HBP1.
Li H, Bian C, Liao L, Li J, Zhao RC
Breast cancer research and treatment 2011 Apr;126(3):565-75
Breast cancer research and treatment 2011 Apr;126(3):565-75
Alterations of the HBP1 transcriptional repressor are associated with invasive breast cancer.
Paulson KE, Rieger-Christ K, McDevitt MA, Kuperwasser C, Kim J, Unanue VE, Zhang X, Hu M, Ruthazer R, Berasi SP, Huang CY, Giri D, Kaufman S, Dugan JM, Blum J, Netto G, Wazer DE, Summerhayes IC, Yee AS
Cancer research 2007 Jul 1;67(13):6136-45
Cancer research 2007 Jul 1;67(13):6136-45
No comments: Submit comment
No validations: Submit validation data